Buy ECG Machine Online – Rmsindia – Medical Equipment Manufacturer – Tele Ecg – Ecg Machine‎

Ultrasound With Color Doppler  Surabi Biomedical Instrumentation – India                   

Digital ECG Machines – Marks Electronic

Multipara Pationt Monitors – Philips Healthcare

Surgical Equipments – Vishal Surgical Equipment

Hospital furniture – Prince Hospital Furniture

Medical Equipment Online Shopping in India, Medical Equipment Online Purchase in India, Medical Equipment Store, Medical Equipment Industry in India, Online Medical Exhibition,   Online Medical Directory, Buy Medical Equipment Online, Medical Equipment Online Store, Medical Equipment Suppliers in India, Medical Equipment Sales in India. Medical equipments India, Medical Equipments Online, Surgical Instruments, Medical Devices, medical equipment online shopping, medical equipment online shopping in india, medical equipment online store india, medical equipment online buy, medical equipment online sales, medical equipment companies in india, medical equipment manufacturers in india, medical equipment suppliers in india, medical online shopping sites, Buy Home Medical Supplies & Equipment online at low prices in India – medusind – http://www.medindus.com/ – ot table manufacturer in india, ot table price in india, ot table manufacturers in india, o t table exporters in india, ot table dealers in india, operation theater light, operation theater pendant, modular operation theater, LED o t light, ot design, 
surgical instruments online shopping,
medical online shopping sites,
medical instruments price list,
online medical equipment sales,
medical equipment in india,
online surgical supply store,
medical equipment online auction,
medical equipment list,

 

MEDINDUS Medical Equipment, Chirakkaparambil Building, 2nd Floor, 54/345, India, Palathuruthu, Kadavanthra, Kochi, Kerala 682020, Phone: 088938 43988. Email:medindusindia@gmail.com


1-0, 1-1, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, m1, m2, m3, m4, m5, m6, m7, m8, m9, m10,…

http://www.medindus.com/ ,
https://www.facebook.com/medindus/ ,
https://www.youtube.com/watch?v=PSvAfBxGNQI ,
https://plus.google.com/104846566444418454391 ,
http://checkwebsiteprice.com/en/cost/medindus.com ,
http://website.informer.com/medindus.com ,
http://websiteworthvalue.org/medindus.com.html ,
http://worthofwebsite.com/medindus.com.html ,
http://directory.entireweb.com/listings/medindus-com/ ,
http://seo.eti.pw/analyser.php?site=www.medindus.com ,
https://www.woorank.com/en/www/medindus.com ,
http://seo.excitesubmit.com/medindus.com ,
http://realwebworth.com/www.medindus.com ,
http://servicehostnet.com/domain/medindus.com ,
http://medindus.com.cubestat.com/ ,
http://www.freeseomarketer.net/www/medindus.com ,
http://howmuchismysite.com/cost/medindus.com ,
http://www.medindus.com/ ,                                                                               https://en.wikipedia.org/wiki/Medical_equipment ,                                                       https://en.wikipedia.org/wiki/India,                                                                                    http://www.medindus.com/1247-2/ ,

 

 

Afghanistan, Albania, Algeria, American Samoa, Andorra, Angola,
Anguilla, Antarctica, Antigua and Barbuda, Argentina, Armenia, Aruba, Australia, Austria, Azerbaijan, Bahamas, Bahrain, Bangladesh, Barbados, Belarus, Belgium, Belize, Benin, Bermuda, Bhutan, Bolivia, Bonaire, Bosnia and Herzegovina, Botswana, Bouvet Island, Brazil, Brunei Darussalam, Bulgaria, Burkina Faso, US Virgin Islands, Burundi, Cambodia, Cameroon, Canada, Cape Verde, Cayman Islands, Central African Republic, Chad, Chile, China, Christmas Island, Cocos Islands, Colombia, Comoros, Congo, Cook Islands, Costa Rica, Croatia, Cuba, Wallis and Futuna, Cyprus, Czech Republic, Denmark, Dominica, Western Sahara, Dominican Republic, Ecuador, Egypt, El Salvador, Equatorial Guinea, Eritrea, Estonia, Ethiopia, Falkland Islands, Faroe Islands, Fiji, Finland, France, French Guiana, French Polynesia,
French Southern Territories, Gabon, Gambia, Georgia, Germany, Ghana, Gibraltar, Greece, Greenland, Grenada, Guadeloupe, Guam, Guatemala, Guernsey, Guinea, Guinea-Bissau, Guyana, Haiti, Holy See, Yemen, Honduras, Hong Kong, Hungary, Iceland, Bharath (India),
Indonesia, Iran, Islamic Republic, Iraq, Ireland, Isle of Man, Israel, Italy, Jamaica, Japan, Jersey, Jordan, Kazakhstan, Kenya, Kiribati, South Korea, north Korea, Kuwait, Kyrgyzstan, Myanmar, Latvia, Lebanon, Lesotho, Liberia, Libya, Liechtenstein, Lithuania, Luxembourg, Macao, Macedonia, Madagascar, Malawi, Malaysia, Maldives, Mali, Malta, Marshall Islands, Martinique, Mauritania, Mauritius, Mayotte, Mexico, Micronesia, Moldova, Monaco, Mongolia, Montenegro, Montserrat, Morocco, Mozambique, Namibia, Nauru, Nepal, Netherlands, New Caledonia, New Zealand, Nicaragua, Niger, Nigeria, Niue, Swaziland, Sweden, Switzerland, Syrian Arab Republic, Taiwan, Palau, Palestine, Panama, Papua New Guinea, Paraguay, Peru, Philippines, Pitcairn, Poland, Portugal, Puerto Rico, Qatar, Romania, Russian Federation, Rwanda, Reunion, Saint Barthalemy, Saint Helena, Saint Kitts and Nevis, Saint Lucia, Saint Martin, Samoa, San Marino, Zambia, Zimbabwe, Sao Tome and Principe, Saudi Arabia, Senegal, Serbia, Seychelles, United Arab Emirates, United Kingdom, United States, Venezuela, Uruguay, Sierra Leone, Singapore, Sint Maarten, Slovakia, Slovenia, Solomon Islands, Somalia, South Africa, South Sudan, Uzbekistan, Spain, Sri Lanka, Sudan, Suriname, Svalbard and Jan Mayen, Tajikistan, Tanzania, Thailand, Timor-Leste, Togo, Tokelau, Tonga, Trinidad and Tobago, Tunisia, Turkey, Turkmenistan, Turks and Caicos , Tuvalu, Uganda, Ukraine, Norfolk Island, Northern Mariana Islands, Norway, Oman, Pakistan, Mumbai(Bombay), Kolkata(Calcutta), Delhi, Chennai(Madras), Bangalore(Bengaluru), Hyderabad, Ahmedabad, Pune, Surat, Jaipur, Kochi(Cochin), Visakhapatnam, Lucknow, Nagpur, Indore, Patna,— Andhra Pradesh Arunachal Pradesh Assam Bihar Chhattisgarh Goa Gujarat Haryana Himachal Pradesh Jammu and Kashmir Jharkhand Karnataka Kerala Madhya Pradesh Maharashtra Manipur Meghalaya Mizoram Nagaland Odisha Punjab Rajasthan Sikkim Tamil Nadu Telangana Tripura Uttar Pradesh Uttarakhand West Bengal Andaman and Nicobar Islands Chandigarh Dadra and Nagar Haveli Daman and Diu Lakshadweep Delhi Puducherry, .us, .de, .fr, .uk, .br, .it, .au, .es, .pl, .in, .com, .net, .org, bsn, apria,  medcon colmed, amazon, medfirstindia, india, america, russia, china, germany, Facebook , Google, Youtube, twitter, Yahoo, rediff, —

medical equipment, medical, equipment, medical equipment online,online, medical equipment sales,sales, medical equipment shopping,shopping, medical equipment suppliers,suppliers, medical equipment store,store, medical equipment companies,companies, medical equipment manufacturers, manufacturers, medical equipment suppliers in india, medical equipment manufacturers in india, medical equipment companies in india, medical equipment dealers, dealers,medical equipment dealers in india, medical equipment distributors, distributors,medical equipment distributors in india,india,m,me,med,medi,medic,medica, medical e,medical eq,medical equ,medical equi,medical equip,medical equipm,medical equipme,medical equipmen,medical equipment,medical devices, medical instruments,devices,instruments,hospital equipments,hospital,equipment, —

 

wikimedcolmedindusjustdialErnakulamMedicalEquipmentDealersenwikipediaorgwikiMedicalequipmentdremeddirindiamarternakulammedicalequipmenthtmlibismedicalnetkeralaindexgehealthcareinenproductscategoriesamazoninHomeMedicalSuppliesEquipmentsmedlineadvancedmedicalequipmentfinanceyahoodomainmecomincoinprogrammemedeuenmediassistindiamedicahospitalsinmedicineamazoncolmedmedfirstindiawikipediaindia… health,medical,fitness,beauty,wellness,medical technology,medical equipment,hospital equipment,medical news,health news,www.com.in.co.in.en.org, https://www.facebook.com/medindus/ – http://bit.ly/2p19ThI – https://www.youtube.com/watch?v=oC7f0V3k6eU https://www.youtube.com/watch?v=HVa5y3Q_F50 https://www.youtube.com/watch?v=HTdEAp8FEPE, 

 

Related searches

Medical Equipments: A-SCANNERABSORBER, ABSORPTION SPECTROMETER, ACOUSTIC BOOTH, ACOUSTIC IMPEDANCE METER / BRIDGE, ACTINOTHERAPY APPARATUS, ACTIVE ELECTRODE, ACUPUNCTURE APPARATUS, ADC / DAC INTERFACE, AIR BED, AIR EMBOLUS DETECTOR, AIR ENTRAINMENT VALVE, AIR VIVA RESPIRATOR / RESUSCITATOR, AIRWAY, AIUM TEST OBJECT, ALDASORBER, AMBU ‘E’ VALVE, AMBU FACEPIECE, AMBU RESPIRATOR / RESUSCITATOR, AMBULATORY ECG MONITOR, ANAESTHETIC CIRCUIT, ANAESTHETIC MACHINE, ANALGESIA APPARATUS ANECHOIC CHAMBER, ANEMOMETER, ANEROID PRESSURE GAUGES, ANTISTATIC CHAIN, ANTISTATIC FLOOR, ANTISTATIC RUBBER APNOEA ALARM / MONITOR, APPLANATION TONOMETER APPLICATOR, ARDRAN-CROOKS CASSETTE, ARRHYTHMIA DETECTOR, ARTERIO-ANGIOGRAPHY APPARATUS, ARTERIOSONDE, ARTERIOVENOUS SHUNT, ARTHROSCOPE, ARTIFICIAL ARTERY, ARTIFICIAL EAR, ARTIFICIAL HEART, ARTIFICIAL HEART VALVE, ARTIFICIAL KIDNEY, ARTIFICIAL LARYNX, ARTIFICIAL LUNG, ARTIFICIAL MASTOID, ARTIFICIAL NOSE, ARTIFICIAL THUMB, ASPIRATOR, ATOMIC ABSORPTION SPECTROMETER, ATOMIZER, AUDIOMETER, AURISCOPE, AUTO ANALYSER, AUTO-GAMMA COUNTER, AUTO-TRANSFORMER, AUTOCLAVE, AVERAGER, AYRES T-PIECE, B-SCANNER, BABYWARMER, BACK BAR, BAG SQUEEZER, BALL FLOAT METER, BALLISTOCARDIOGRAPH, BARANY BOX, BASKET ANAESTHETIC MACHINE, BED WEIGHING SYSTEM, BEKESY AUDIOMETER, BELT RESPIRATOR, BETA COUNTER,BETATRON, BI-STABLE STORAGE CATHODE RAY TUBE (CRT), BIOFEEDBACK APPARATUS, BIPOLAR COAGULATOR, BIPOLAR SURGICAL DIATHERMY, BLADDER STIMULATOR, BLOOD FLOW METER, BLOOD GAS ANALYSER, BLOOD LEAK DETECTOR, BLOOD LEVEL DETECTOR, BLOOD LOSS METER,

BLOOD PRESSURE MONITOR / METER,

BLOOD PUMP,

BLOOD VELOCITY METER,

BLOOD WARMER,

BLOW-OFF VALVE,

BODOK SEALS,

BODY BOX,

BODY RESPIRATOR,

BONE CONDUCTION TRANSDUCER / RECEIVER,

BONE SAW,

BONE VIBRATOR,

BOSUN OXYGEN FAILURE WARNING DEVICE,

BOURDON GAUGE (MANOMETER),

BOYLES BOTTLE (VAPORIZER),

BOYLES MACHINE,

BRACHIAL STETHOSCOPE,

BREAST PUMP,

BREATHING CIRCUIT,

BREATHING MACHINE,

BREATHING TUBE / HOSE, BRONCHOSCOPE

BUBBLE OXYGENATOR,

BUBBLE TRAP,

BUCKY DIAPHRAGM,

BULL-NOSED CYLINDER VALVES,
C-SCANNER (ULTRASONIC),

CABINET VENTILATOR, CALIPERS (ULTRASONIC)

CALORIC APPARATUS,

CALORIMETER,

CAPNOMETER / CAPNOGRAPH, CARBON DIOXIDE ABSORBER

CARBON DIOXIDE ANALYSER,

CARBON DIOXIDE CYSTOMETER,

CARBON DIOXIDE INSUFFLATION APPARATUS,

CARBON MONOXIDE ANALYSER,

CARDIAC ANGIOGRAPHY APPARATUS,

CARDIAC CATHETERIZATION EQUIPMENT,

CARDIAC MICROPHONE,

CARDIAC OUTPUT COMPUTER

CARDIAC PACEMAKER

CARDIFF INFUSION SYSTEM

CARDIFF SWIVEL

CARDIOPULMONARY BYPASS APPARATUS

CARDIOSCOPE

CARDIOTACHOMETER

CARDIOTOCOGRAPH

CARDIOVERTER

CAST CUTTER

CAT SCANNER

CATHETER MOUNT

CATHETER PULLER

CATHODE RAY TUBE

CATHOLYSIS UNIT

CAUTERY UNIT

CENTRAL VENOUS PRESSURE (CVP) MONITOR

CENTRIFUGAL ANALYSER

CENTRIFUGE

CEREBRAL FUNCTION MONITOR

CHART RECORDER

CHECKERBOARD STIMULATOR

CHEMICAL THERMOMETER

CHROMATOGRAPH

CINEANGIOGRAPHY APPARATUS

CIRCLE ABSORBER

CLARK ELECTRODE

CLOSED CIRCUIT

COBALT-60 TREATMENT UNIT

COCHLEA IMPLANT

COLD LIGHT SOURCE

COLONOSCOPE

COLORIMETER

COLPOSCOPE

COMPOUND (ULTRASONIC) SCANNER

COMPUTER

CONDUCTIVITY METER

CONSTANT VOLTAGE TRANSFORMER

CONTINUOUS AMBULATORY PERITONEAL DIALYSIS (CAPD)

CONTINUOUS FLOW ANALYSER

COOLIDGE TUBE

COPPER KETTLE (VAPORIZER)

COULTER COUNTER

CRYOSURGERY APPARATUS

CRYOTHERAPY APPARATUS

CT SCANNER

CUIRASS VENTILATOR

CULDOSCOPE

CURRENT BATH

CUVETTE

CYSTOMETER

CYSTOSCOPE
DE-AERATOR

DE-IONIZER

DEFIBRILLATOR

DEFIBRILLATOR TESTER

DELAYED AUDITORY FEEDBACK MACHINE

DEMAND FLOW ANALGESIA APPARATUS

DENSITOMETER

DEPILATOR

DIALYSATE CONDUCTIVITY METER

DIALYSATE PRESSURE MONITOR

DIALYSATE PROPORTIONATING PUMP

DIALYSER

DIALYSER WASHOUT DEVICE

DIALYSIS CLAMP

DIATHERMY EQUIPMENT

DIATHERMY TESTER

DIFFERENTIAL AMPLIFIER

DISCRETE SAMPLE ANALYSER

DISPERSIVE ELECTRODE

DOPPLER (ULTRASONIC) BLOOD PRESSURE MONITOR

DOPPLER BLOOD FLOW / VELOCITY METER

DOPPLER FOETAL HEART DETECTOR / MONITOR

DOPPLER ULTRASONIC SCANNER

DOSE-RATE METER

DOSEMETER / DOSIMETER

DRAGER VOLUMETER

DRAW-OVER APPARATUS

DRAW-OVER VAPORIZER

DRINKER APPARATUS

DROP COUNTER / RATEMETER

DROP DETECTOR HEAD

DYE DILUTION COMPUTER

DYNAMOMETER
EAR MOULD

EARTH LEAKAGE CIRCUIT BREAKER (ELCB)

EARTH LEAKAGE CURRENT METER / MONITOR

EARTH LOOP TESTER

EAST RADCLIFFE VENTILATOR

ECG MONITOR

ECHOCARDIOGRAPH

ECHOENCEPHALOGRAPH

EDINBURGH MASKER

ELECTRET MICROPHONE

ELECTRIC RESPONSE AUDIOMETER (ERA)

ELECTRICAL IMPEDANCE CARDIAC OUTPUT COMPUTER

ELECTRICAL STIMULATOR

ELECTRO-AEROMETER

ELECTRO-OCULOGRAPH

ELECTROANAESTHESIA APPARATUS

ELECTROANALGESIA APPARATUS

ELECTROCARDIOGRAPH

ELECTROCAUTERY APPARATUS

ELECTROCOCHLEOGRAPH

ELECTROCONVULSIVE THERAPY APPARATUS

ELECTRODE

ELECTROENCEPHALOGRAPH (EEG)

ELECTROGLOTTOGRAPH

ELECTROGUSTOMETER

ELECTROLYSIS UNIT

ELECTROMAGNETIC BLOOD FLOWMETER

ELECTROMYOGRAPH (EMG)

ELECTRONARCOSIS APPARATUS

ELECTRONYSTAGMOGRAPH (ENG)

ELECTROPHORESIS APPARATUS

ELECTRORETINOGRAPH

ELECTROSLEEP APPARATUS

ELECTROSURGERY UNIT

ELECTROTHERAPY APPARATUS

ELEPHANT TUBING

EMERSON CUIRASS VENTILATOR

EMI SCANNER

EMISSION SPECTROSCOPE

EMISSION TOMOGRAPHY (ECAT) SCANNER

ENDOBRONCHIAL TUBE

ENDORADIOSONDE

ENDOSCOPE

ENDOTRACHEAL CONNECTOR

ENDOTRACHEAL TUBE

ENTONOX APPARATUS

ENZYME ANALYSER

EPILATION UNIT

ERGOMETRIC RECORDING SYSTEM

EVOKED RESPONSE AVERAGER

EXETER LIP SENSOR

EXETER VISUAL SPEECH AID

EXPIRATORY VALVE

EYE MAGNET
FACE MASK

FACEPIECE

FARADAY CAGE

FARADIC TREATMENT UNIT

FEED MOUNT

FIBRE-OPTIC LIGHT SOURCE

FIBRE-OPTIC RECORDER

FIBRILLATOR

FICK CARDIAC OUTPUT COMPUTER

FILM BADGE

FILM CHANGER

FISTULA MONITOR

FLAME PHOTOMETER

FLATBED RECORDER

FLEISCH TUBE

FLEXOPLATE

FLEXOPLATE MONITOR

FLOATING ELECTRODE

FLOW-DIRECTED CATHETER

FLOWMETER

FLUORESCENCE SPECTROMETER

FLUORIMETER (FLUOROMETER)

FLUOROSCOPE

FLUOTEC

FM TAPE RECORDER

FOETAL ELECTROCARDIOGRAPH

FOETAL HEART DETECTOR

FOETAL MONITOR / RECORDER

FOGGING MACHINE

FORCE PLATE / PLATFORM

FORMALIN STERILIZING UNIT / CABINET

FRAME-FREEZE MODULE

FRASER SWEATMAN PIN SAFETY SYSTEM

FREE-FIELD AUDIOMETER

FRENZEL GLASSES

FUEL CELL OXYGEN ANALYSER

FUMIGATION UNIT

FUNCTIONAL ELECTRICAL STIMULATOR (FES)

FUNCTIONAL RESIDUAL CAPACITY (FRC) ANALYSER
GALVANOMETRIC RECORDER

GAMMA CAMERA

GANZFELD STIMULATOR

GAS CYLINDER

GAS MIXING VALVE

GAS-LIQUID CHROMATOGRAPH (GLC)

GASTRIC PUMP

GASTROSCOPE

GEIGER-MULLER TUBE

GLOTTOGRAPH

GOLDMAN INHALER

GOLDMAN VAPORIZER

GONIOMETER

GRENTZ-RAY SET

GREY SCALE DISPLAY UNIT

GROMMET

GUARD RING TOCOGRAPH

GUSTOMETER
HAEMACYTOMETER / HAEMOCYTOMETER

HAEMATOCRIT CENTRIFUGE

HAEMODIALYSIS MACHINE

HAEMOFILTRATION APPARATUS

HAEMOHEATER

HAEMOPERFUSION APPARATUS

HAEMOTONOMETER

HALDANE APPARATUS

HARDENING FILTER

HEAD HARNESS

HEADPHONE

HEARING AID

HEARING AID TEST BOX

HEART RATE METER

HEART SIMULATOR

HEART-ASSIST DEVICE

HEART-LUNG MACHINE

HEAT CAMERA

HEAT TREATMENT UNIT

HEATED GLOVES / SOCKS

HEATED RIPPLE MATTRESS

HEATING BATH

HEATLAMP

HEIDBRINK VALVE

HELIUM DILUTION (FRC) ANALYSER

HEPARIN PUMP

HIS BUNDLE ANALYSER

HOT PACK HEATER

HUMIDIFIER

HYDROCOLLATOR PACK

HYDROTHERAPY APPARATUS

HYFRECATOR

HYPERBARIC THERAPY APPARATUS
IMAGE INTENSIFIER

IMPEDANCE BRIDGE

IMPEDANCE PLETHYSMOGRAPH

INCUBATOR

INDIFFERENT ELECTRODE

INDUCTIVE LOOP

INDUCTOTHERMY APPARATUS

INFRARED CAMERA

INFRARED CARBON DIOXIDE ANALYSER

INFRARED LAMP

INFRARED VIEWER

INFUSION CONTROLLER

INFUSION PUMP

INJECTOR SUCTION UNIT

INK-JET RECORDER

INSUFFLATION APPARATUS

INTEGRATOR

INTERFERENTIAL TREATMENT UNIT

INTERMITTENT BLOWER VENTILATOR

INTERMITTENT COMPRESSION APPARATUS

INTERMITTENT FLOW APPARATUS

INTERMITTENT POSITIVE PRESSURE VENTILATOR (IPPV)

INTRA-AORTIC BALLOON

ION SELECTIVE ELECTRODE

IONTOPHORESIS APPARATUS

IRON LUNG

ISOLATING TRANSFORMER

ISOLETTE NEGATIVE PRESSURE APPARATUS

ISOTOPE COW

ISOTOPE SCANNER
JACKSON REES PAEDIATRIC T-TUBE
KATHAROMETER

KROMAYER LAMP

kVp METER

KYMOGRAPH
LARYNGOGRAPH

LARYNGOSCOPE

LASER (SURGICAL)

LEAKAGE CURRENT MONITOR

LIGHT BEAM DIAPHRAGM

LIGHT PEN

LIGHT PLETHYSMOGRAPH

LINEAR ACCELERATOR

LINEAR ARRAY (ULTRASOUND) SCANNER

LINEAR VARIABLE DIFFERENTIAL TRANSFORMER (LVDT)

LIQUID OXYGEN SUPPLY

LIQUID SCINTILLATION COUNTER

LITHOTRIPTOR

LOAD CELL TRANSDUCER

LOW-RESISTANCE VAPORIZER

LUNG VENTILATOR
M-MODE (ULTRASONIC) SCANNER

MAGILL ATTACHMENT

MAMMOGRAPHY SYSTEM

MANLEY VENTILATOR

MAPLESON BREATHING CIRCUIT

MARSHALL’S INDICATOR

MASKER

MASS SPECTROSCOPE / SPECTROGRAPH

MAVIS (Movable Arterial and Venous Imaging System)

McKESSON BREATHING CIRCUITS

McKESSON EXPIRATORY VALVE

McKESSON INHALER

MECHANICAL THUMB VENTILATOR

MEDICAL COMPRESSED AIR

MEMORY OSCILLOSCOPE

MERCURY MANOMETER

MERCURY PLETHYSMOGRAPH

METAL FRAGMENT DETECTOR

MICROELECTRODE

MICROTOME

MICROWAVE DIATHERMY APPARATUS

MIDLINER

MINUTE VOLUME DIVIDER

MODEM

MONITORED DEFIBRILLATOR

MONOCHROMATOR

MOTORIZED SYRINGE

MR SCANNER

MULTICHANNEL ANALYSER

MULTIFORMAT CAMERA

MYOPHONE
NASAL ANEMOMETER

NEBULIZER

NEPHELOMETER

NEPHROSCOPE

NERVE STIMULATOR

NEUTRAL ELECTRODE

NITROGEN ANALYSER

NUCLEAR MAGNETIC RESONANCE (NMR) SCANNER

NYSTAGMOGRAPH
OCTAVE BAND ANALYSER

OCTOSON

OESOPHAGEAL PACEMAKER

OESOPHAGEAL STETHOSCOPE

OIL HEATING BATH

OPEN CIRCUIT

OPEN DROP MASK

OPHTHALMODYNAMOMETER

OPHTHALMOMETER

OPHTHALMOSCOPE

OPTOKINETIC DRUM

ORTHOSIS

ORTHOVOLTAGE X-RAY SET

OSCILLATING SAW

OSCILLOMETER

OSCILLOSCOPE

OSCILLOTONOMETER

OSMOMETER

OTOACOUSTIC EMISSION PROCESSOR / AUDIOMETER

OTOSCOPE

OVERHEAD BABY WARMER

OXIMETER

OXYGEN ANALYSER

OXYGEN BYPASS (FLUSH) CONTROL

OXYGEN CONCENTRATOR

OXYGEN FAILURE WARNING DEVICE

OXYGENATOR
PACEMAKER

PACEMAKER ANALYSER

PANENDOSCOPE

PARAMAGNETIC OXYGEN ANALYSER

PASTEURIZER

PATIENT CIRCUIT

PATTERN GENERATOR

PEAK FLOWMETER

PEEP VALVE

PENETRAMETER

PERIMETER

PERIPHERAL NERVE STIMULATOR

PERISTALTIC PUMP

PERITONEAL DIALYSIS CLAMP

PERITONEAL DIALYSIS MACHINE

PEROMETER

pH METER

PHASED ARRAY (ULTRASONIC) SCANNER

PHONIC EAR

PHONIC MIRROR

PHONOCARDIOGRAPH

PHONOCATHETER

PHONOPHORESIS APPARATUS

PHOTIC STIMULATOR

PHOTOMETER

PHOTOMULTIPLIER (PM) TUBE

PHOTOPLETHYSMOGRAPH

PHOTOTHERAPY APPARATUS

PIN-INDEX SYSTEM

PINKERTON CUIRASS VENTILATOR

PIPED MEDICAL GAS SUPPLY

PIPED VACUUM SERVICE

PISTONPHONE

PLAN POSITION INDICATOR (ULTRASONIC) SCANNER

PLASMA SCALPEL

PLETHYSMOGRAPH

PNEUMOGRAPH

PNEUMOTACHOMETER / GRAPH

POLAROGRAPHIC CELL

POLYGRAPH

POP-OFF VALVE

POTASSIUM ION ANALYSER

POTENTIOMETRIC RECORDER

POTTER-BUCKY DIAPHRAGM

PRESSURE REGULATOR

PRESSURE RELIEF VALVE

PRESSURE TRANSDUCER

PROCTOSCOPE

PROFILOMETER

PROGRESSIVE TREATMENT UNIT

PROPORTIONING PUMP

PROSTHESIS

PULSE DUPLICATOR

PULSE HEIGHT ANALYSER

PULSE MONITOR

PULSE RATE METER

PULSED WAVE DOPPLER ULTRASONIC FLOWMETER

PUMP

PUPILLOMETER

PURE TONE AUDIOMETER

PUVA SKIN TREATMENT APPARATUS
RADIANT HEAT LAMP

RADIATION PRESSURE (FORCE) BALANCE

RADIATION THERMOMETER

RADIO PILL

RADIOTHERAPY EQUIPMENT

RADIUM NEEDLE

RADIUM TUBE

RANGE-GATED DOPPLER ULTRASONIC FLOWMETER

REACTION RATE ANALYSER

REAL-TIME ULTRASONIC SCANNER

REBREATHING BAG

REBREATHING CIRCUIT

RECTILINEAR SCANNER

REES T-PIECE PAEDIATRIC CIRCUIT

REGULATOR

RELAXOMETER

RESERVOIR BAG

RESPIRABLE AIR PUMP

RESPIRATOR

RESPIROMETER

RESUSCITATOR

RETINOSCOPE

REVERSE OSMOSIS MACHINE

RIPPLE BED / MATTRESS

ROCKING APPARATUS

ROLLER PUMP

ROTAMETER

RUBEN’S VALVE
SALT VALVE

SCAN CONVERTER

SCAVENGING SYSTEM

SCHIMMELBUSCH MASK

SCINTILLATION CAMERA

SCINTILLATION COUNTER

SCREENING AUDIOMETER

SEALED SOURCE

SECTION (ULTRASOUND) SCANNER

SEMI-CLOSED CIRCUIT

SENSITOMETER

SHAKER

SHORT-WAVE DIATHERMY APPARATUS

SIEGLES SPECULUM

SIGMOIDOSCOPE

SINGLE-NEEDLE DEVICE

SKIN RESISTANCE METER

SLIT LAMP

SMART BRISTOW FARADIC COIL

SONA-GRAPH

SOUND LEVEL METER

SPECTRASCRIBE

SPECTROPHOTOMETER

SPEECH AMPLIFIER

SPEECH AUDIOMETER

SPEECH SYNTHESIZER

SPEECH TRAINER

SPHYGMOMANOMETER

SPINNING TOP

SPIROMETER / SPIROGRAPH

STAT ANALYSER

STEP WEDGE

STERILIZER

STEROTONER

STETHOSCOPE

STIRRER

STOMACH PUMP

STOP-ACTION (ULTRASONIC) SCANNER

STORAGE CATHODE RAY TUBE

STRAIN GAUGE TRANSDUCER

SUCTION CATHETER

SUCTION ELECTRODE

SUCTION MACHINE

SUCTION THERAPY APPARATUS

SUPERFICIAL X-RAY TREATMENT UNIT

SURGICAL DIATHERMY MACHINE

SWAN-GANZ CATHETER

SYRINGE PUMP
T-PIECE CIRCUIT

TAPE RECORDER

TcpO2 MONITOR

TELEISOTOPE UNIT

TELEMETRY

TELETHERAPY APPARATUS

THERAKTIN TUNNEL BATH

THERAPEUTIC DIATHERMY EQUIPMENT

THERMISTOR

THERMOCOUPLE

THERMODILUTION CARDIAC OUTPUT COMPUTER

THERMOGRAPH

THERMOLUMINESCENT DOSIMETRY APPARATUS

THERMOMETER

TIME COMPRESSION ANALYSER

TIME-MOTION (TM) SCANNER

TINNITUS MASKER

TOCODYNAMOMETER

TOMOGRAPHIC X-RAY UNIT

TONOMETER

TOURNIQUET

TRACHEOSTOMY TUBE

TRACTION APPARATUS

TRANSCUTANEOUS AORTIC VELOGRAPH (TAV)

TRANSCUTANEOUS ELECTRICAL NEURAL STIMULATOR (TENS)

TRANSDUCER

TRANSFER FACTOR ANALYSER

TRANSIENT RECORDER

TRANSMISSION-MODE (ULTRASONIC) SCANNER

TREADMILL

TREND RECORDER

TUNING FORK

TUNNEL BATH

TURBIDIMETER

TYMPANOMETER
ULTRAFILTRATION APPARATUS

ULTRAFILTRATION MONITOR

ULTRASONIC BLOOD FLOW RATE METER

ULTRASONIC BLOOD PRESSURE MONITOR

ULTRASONIC CLEANING BATH

ULTRASONIC DIATHERMY APPARATUS

ULTRASONIC MASSAGER

ULTRASONIC NEBULIZER

ULTRASONIC SCANNER

ULTRASONIC STETHOSCOPE

ULTRASONIC TRANSDUCER

ULTRASONIC TREATMENT UNIT

ULTRAVIOLET RECORDER

ULTRAVIOLET TREATMENT LAMP

URETHROSCOPE

URILOS ELECTRONIC NAPPY

URINOMETER

URODYNAMIC APPARATUS

UROFLOWMETER
VACUUM CONTROL VALVE

VACUUM PUMP

VACUUM UNIT

VAPORIZER

VASCULAR DILATOR

VECTORCARDIOGRAPH

VENOUS OCCLUSION PLETHYSMOGRAPH

VENOUS PRESSURE MONITOR

VENTILATOR

VENTILATOR ALARM

VIBROMASSAGER

VISUAL DISPLAY UNIT

VISUAL FIELD ANALYSER

VITAL SIGNS MONITOR

VITALOGRAPH

VOCODER

VOISCOPE

VOLUMETRIC INFUSION PUMP
WALKING PLATFORM

WALL SUCTION UNIT

WARBLE-TONE AUDIOMETER

WATER BATH

WATER BED / MATTRESS

WATER MANOMETER

WATER SOFTENER

WATERS CANISTER

WAX BATH

WEIGHING BED

WELL COUNTER

WHIRLPOOL BATH

WILLIAMS FILTER

WISCONSIN TEST CASSETTE

WRIGHT PEAK FLOWMETER

WRIGHT’S RESPIRATION MONITOR / METER

WRIGHT’S RESPIROMETER
X-RAY FILM CASSETTE

X-RAY SET

X-RAY THERAPY APPARATUS

X-RAY TUBE

X-Y RECORDER

XENOGRAFT

XERORADIOGRAPHY APPARATUS
ZERO-CROSSING RATEMETER —